PIR_MOUSE Q9D711
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D711
Recommended name：Pirin
EC number：EC 1.13.11.24
Alternative names：(Probable quercetin 2,3-dioxygenase PIR) (Probable quercetinase)
Cleaved into：
GeneID：69656
Gene names (primary )：Pir
Gene names (synonym )：
Gene names (ORF )：
Length：290
Mass：32066
Sequence：MASSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGKPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHVGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRRSEKMVAPQYQELKSEEIPKPTKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDQGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDAVQLENKDPKRSHFVLIAGEPLREPVVQHGPFVMNTNEEISQAILDFRNAKNGFEGARTWKSKIGN
Tissue specificity：Weakly expressed in bone marrow. {ECO:0000269|PubMed:20010624}.
Induction：Down-regulated in mice with acute myeloid leukemias induced by either PML-RAR or AML1-ETO fusion oncoproteins. {ECO:0000269|PubMed:20010624}.
Developmental stage：
Protein families：Pirin family