SLIK4_MOUSE   Q810B8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q810B8

Recommended name:SLIT and NTRK-like protein 4

EC number:

Alternative names:

Cleaved into:

GeneID:245446

Gene names  (primary ):Slitrk4

Gene names  (synonym ):

Gene names  (ORF ):

Length:837

Mass:94538

Sequence:MFLWLFLIVSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFVNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQQENGFTTPNGHTTQTTLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPVPCFCKTHPSDLGLSVNCQEKNIQSMSELTPKPLNAKKLHVNGNNIKDVDISDFTEFEGLDLLHLGSNQITLIKGEVFHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWLEKLNDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSATFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNSECGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVMMRNAADKDKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQQDKKNKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI

Tissue specificity:In the adult, significant expression is detected only in the brain. Broadly expressed in embryonic brain with highest expression in subventricular zone, subplate, cortical plate, pyramidal cell layer of hippocampus, thalamus and hypothalamus. {ECO:0000269|PubMed:14550773}.

Induction:

Developmental stage:In the embryo, expressed from day 10-12 and continues through later gestational development and into adulthood. {ECO:0000269|PubMed:14550773}.

Protein families:SLITRK family


   💬 WhatsApp