RAB3D_RAT Q63942
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63942
Recommended name：GTP-binding protein Rab-3D
EC number：EC:3.6.5.2
Alternative names：
Cleaved into：
GeneID：140665
Gene names (primary )：Rab3d
Gene names (synonym )：Rab16
Gene names (ORF )：
Length：219
Mass：24,290
Sequence：MASASEPPASPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFTAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVSAEDGQRLAGDLGFEFFEASAKENINVKQVFERLVDIICDKMNESLEPSSSPGSNGKGPALGDTPPPQPSSCGC
Tissue specificity：Highest levels found in lung. 1
Induction：
Developmental stage：
Protein families：