PLD3_MOUSE O35405
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35405
Recommended name：5'-3' exonuclease PLD3
EC number：EC 3.1.16.1
Alternative names：(Choline phosphatase 3) (Phosphatidylcholine-hydrolyzing phospholipase D3) (Phospholipase D3) (PLD 3) (Schwannoma-associated protein 9) (SAM-9)
Cleaved into：
GeneID：18807
Gene names (primary )：Pld3
Gene names (synonym )：Sam9
Gene names (ORF )：
Length：488
Mass：54389
Sequence：MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLRDWESPYSHDLDTSANSVGNACRLL
Tissue specificity：Expressed at higher level in brain than in non-nervous tissue. Expressed in mature neurons of the forebrain and appears to be turned on at late stages of neurogenesis. Expressed during late neuronal development in the forebrain (PubMed:9813063). Expressed in the pyramidal neurons of the cortex and hippocampus (PubMed:28128235). Low expression in the cerebellum (PubMed:30312375). {ECO:0000269|PubMed:28128235, ECO:0000269|PubMed:30312375, ECO:0000269|PubMed:9813063}.
Induction：Up-regulated during myoblast differentiation into myotubes. {ECO:0000269|PubMed:22428023}.
Developmental stage：
Protein families：Phospholipase D family