CXB2_MOUSE Q00977
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q00977
Recommended name：Gap junction beta-2 protein
EC number：
Alternative names：(Connexin-26) (Cx26)
Cleaved into：
GeneID：14619
Gene names (primary )：Gjb2
Gene names (synonym )：Cxn-26
Gene names (ORF )：
Length：226
Mass：26411
Sequence：MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHHFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEEIKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDCFISRPTEKTVFTVFMISVSGICILLNITELCYLFVRYCSGKSKRPV
Tissue specificity：Detected in cochlea (at protein level) (PubMed:15692151). Detected in cochlea (PubMed:15692151). Liver, kidney, intestine, lung, spleen, stomach, testis and brain, but not heart and adult skeletal muscle. {ECO:0000269|PubMed:15692151}.
Induction：
Developmental stage：Detected in cochlea after 14.5 dpc. Detected in the spiral limbus in neoneates at 2, 8 and 12 days after birth, before the onset of hearing. {ECO:0000269|PubMed:15692151}.
Protein families：Connexin family, Beta-type (group I) subfamily