EGLN1_RAT P59722
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59722
Recommended name:Egl nine homolog 1
EC number:EC:1.14.11.29
Alternative names:Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2; HIF-prolyl hydroxylase 2; HPH-2) Prolyl hydroxylase domain-containing protein 2 (PHD2)
Cleaved into:
GeneID:
Gene names (primary ):Egln1
Gene names (synonym ):
Gene names (ORF ):
Length:338
Mass:36,093
Sequence:PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV
Tissue specificity:Expressed in heart, liver, kidney, brain, liver and testis. Highest levels in heart, lowest in liver. 1
Induction:
Developmental stage:Up-regulated by hypoxia especially in liver and testis. Levels up-regulated also in myocardial infarction predominantly in cardiomyocytes. 2 s
Protein families: