ANR49_MOUSE Q8VE42
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VE42
Recommended name：Ankyrin repeat domain-containing protein 49
EC number：
Alternative names：(Fetal globin-increasing factor) (Fetal globin-inducing factor)
Cleaved into：
GeneID：56503
Gene names (primary )：Ankrd49
Gene names (synonym )：Fgif Gbif
Gene names (ORF )：
Length：238
Mass：27111
Sequence：MEKEKKDDEKPDLENSVDFSEQFNQLELLKTHGHLIPTGTQSLWVGNSDEDEEQEEKNEEWYQLQEKKMEKDPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHIDVVRELVAKGADVHAVTVDGWTPLHSACKWNNTKVASFLLQHDADINAQTKGLLTPLHLAAGNRDSRDTLELLLMNRYIKPELKNNSQETASDIARRTSIYHYLFEIAEGCTNSSPPS
Tissue specificity：Expressed in spermatogonia, spermatocytes and round spermatids. {ECO:0000269|PubMed:26043108}.
Induction：
Developmental stage：Expressed in liver at embryonic stage 13 dpc, and in liver, brain and lung at 16 dpc (PubMed:11162141). In testis, expression levels steadily increase from 1 week after birth and plateau by 8 weeks after birth (PubMed:26043108). {ECO:0000269|PubMed:11162141, ECO:0000269|PubMed:26043108}.
Protein families：