CATB_RAT   P00787


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P00787

Recommended name:Cathepsin B

EC number:EC:3.4.22.1

Alternative names:Cathepsin B1 RSG-2

Cleaved into:

GeneID:

Gene names  (primary ):Ctsb

Gene names  (synonym ):

Gene names  (ORF ):

Length:339

Mass:37,470

Sequence:MWWSLIPLSCLLALTSAHDKPSSHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPNLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF

Tissue specificity:Expressed in the epithelial cells of the prostate and mammary gland. 1

Induction:

Developmental stage:Expression is low in the lactacting mammary gland but increases after weaning to a peak 4 days post weaning. Expression returns to baseline levels 6 days post weaning. 1

Protein families:


   💬 WhatsApp