PRDX1_MOUSE   P35700


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35700

Recommended name:Peroxiredoxin-1

EC number:EC 1.11.1.24

Alternative names:(Macrophage 23 kDa stress protein) (Osteoblast-specific factor 3) (OSF-3) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1)

Cleaved into:

GeneID:18477

Gene names  (primary ):Prdx1

Gene names  (synonym ):Msp23 Paga Tdpx2

Gene names  (ORF ):

Length:199

Mass:22176

Sequence:MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK

Tissue specificity:Found in various tissues; high concentration in liver.

Induction:By oxidative and sulfhydryl-reactive agents.

Developmental stage:

Protein families:Peroxiredoxin family, AhpC/Prx1 subfamily


   💬 WhatsApp