THYN1_MOUSE Q91YJ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91YJ3
Recommended name：Thymocyte nuclear protein 1
EC number：
Alternative names：(Thymocyte protein Thy28) (mThy28)
Cleaved into：
GeneID：77862
Gene names (primary )：Thyn1
Gene names (synonym )：Thy28
Gene names (ORF )：
Length：226
Mass：26178
Sequence：MPRPRKRQTGTAGPDRKKLSGKRTKTENSESTSVKLENSSLEMTTTFKNGGKNLSNYWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFYHSNCKQPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIPLEELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEFDFILSLEETEPS
Tissue specificity：Expressed in the medulla containing mature thymocytes, but not the cortex having immature thymocytes (at protein level). Abundant expression seen in testis, liver, brain and kidney with lower levels of the expression in thymus, spleen, heart and stomach. {ECO:0000269|PubMed:12384300, ECO:0000269|PubMed:14580360, ECO:0000269|PubMed:14601557}.
Induction：Down-regulated upon induction of apoptosis. {ECO:0000269|PubMed:14580360, ECO:0000269|PubMed:14601557}.
Developmental stage：
Protein families：