RAC1_MOUSE   P63001


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63001

Recommended name:Ras-related C3 botulinum toxin substrate 1

EC number:EC 3.6.5.2

Alternative names:(p21-Rac1)

Cleaved into:

GeneID:19353

Gene names  (primary ):Rac1

Gene names  (synonym ):

Gene names  (ORF ):

Length:192

Mass:21450

Sequence:MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:1905006}.

Induction:

Developmental stage:Expressed in the neocortical neurons in the developing brain. {ECO:0000269|PubMed:22959435}.

Protein families:Small GTPase superfamily, Rho family


   💬 WhatsApp