PIOS1_RAT C0HLN0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:C0HLN0
Recommended name：Protein PIGBOS1 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：100909598
Gene names (primary )：Pigbos1
Gene names (synonym )：
Gene names (ORF )：
Length：54
Mass：6,358
Sequence：MLRRLTRPQLLFAAALGVAGGMYIYQPIFEQYSRDQKELKEKVKILQESEEKRS
Tissue specificity：Detected in a number of tested tissues including pancreas, brain, heart, kidney, liver, thymus and white adipose tissue (at protein level). 1
Induction：
Developmental stage：
Protein families：