TR103_RAT Q67ET5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q67ET5
Recommended name:Taste receptor type 2 member 103
EC number:
Alternative names:Taste receptor type 2 member 15 (T2R15)
Cleaved into:
GeneID:100310886
Gene names (primary ):Tas2r103 By Similarity
Gene names (synonym ):Tas2r15
Gene names (ORF ):
Length:312
Mass:34,961
Sequence:MVVTMRAALRLMLISTVSLELIIGILANVFIALVNIIDWIKRGKISAVDKIYMGLAISRTAFVLSVITGFLIAFLDPASLGIGIMIRLLTMSWTVTNHFSVWFATCLSIFYFLKITNFSNTVFLALKWKVKKVVSVTLVVSLIILFINVIVIHIYTDRFQVNMVQKCGANNTLRAYGLFLSISTVFTFIPFTASLTMFLLLIFSLWRHLKTMHHNATGSRDVSTVAHIKGLQTVVAFLLLYTVFAMSLFSQSLSIDAQHTNLLSHFLRCIGVAFPSGHSCALILGNNKLRQASLSVIFWLRCKYKHTENQGP
Tissue specificity:
Induction:
Developmental stage:
Protein families: