ICE2_MOUSE   Q3UZ18


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UZ18

Recommended name:Little elongation complex subunit 2

EC number:

Alternative names:(Interactor of little elongator complex ELL subunit 2) (NMDA receptor-regulated protein 2)

Cleaved into:

GeneID:93697

Gene names  (primary ):Ice2

Gene names  (synonym ):Narg2

Gene names  (ORF ):

Length:988

Mass:109879

Sequence:MSSSITMSEPRLNWDVTPKNGLKAFFSPENYKDHSMAPSLKELYILSNRRIGENLSVSASSVENEPAVSSATQAKEKVGMILLPKPRVPYPRFSRFSQREQRTYVDLLAKYAKLPSSSKTVGTNTNEYLQYLDMKKHVNEEVNEFLKFLQNSAKKCAQDYNMLSDEARLFTEQLLRACIEQVKKYPEFYTLHEVTSLMGFFPFKTEMGLKLEKTLLVLGSAKFVKTAFPSMPVKLQLSKEDMSSIETPQQKAEVMHCDISKDPNAEKLVSRYHPQIALTSQALFTLLNNHGPSYKEQWEIPVCVEMIAVEGSKPVKVIYINSPLPRKQMTMRERNQIFHEVPLKHIISKNTSVPVSAVFMDKPEEYTSEVDMPTEAGECRKIETLENLDMDFDGDVTELETFGVTTTSPPRSPSSESDSSAPLMTDVHAVPKIAAVPLAPATPVAPTMPVAPATPVTPTMPMAPATPEASATPNITDDSRSLCQILMKQLQKEKQLFSGVEGGPEGCKNKDDQGLEPCGEEVPSANAKSLTQDNEVHRTEGISKESDVGVLCTNDERQGGQGNANNPNNTATASEAAESEKGIPCGSDTDEDCLIIDTESRSCDGKTADLGSRPNSSAQASAGNQATTTVSEESCVLKKPIKRVYKKFDPVGEILKMQDELLKPVSRKVPELPLTNSEESKQPPASEQPSAALDAAPWPKSSWPSAFQKPKGRLPYELQDYVEDTSEYIAPQEGNFVYKLFSLQDLLLLVRCSIQRVETRPRSKKRKKIRRQFPVYVLPKVEYQGCYGVEALTESELCRFWTESLLHSNCSFYVGHIDAFTSKLFMLEEIASEELKEKLAALKISSLFNILQHILKKLCSLQEGSYLLSHAAEDSSLLIYKTSDGKVTRTAYNLHKAHCDLPGVPSSLSVPWVPLDPSYLLPYHIHHGRVPCTFPPKPLRPAAQAKVGGTRMPTRNHRNPVSMETKSSCLPVQQVENEGVARNKRKIM

Tissue specificity:Expressed in brain, kidney, liver and testis. {ECO:0000269|PubMed:11297529}.

Induction:Down-regulated during neuronal differentiation, probably by NMDA receptor. {ECO:0000269|PubMed:11297529, ECO:0000269|PubMed:15606750}.

Developmental stage:Expressed in brain from 13 dpc to P0, and down-regulated after birth. {ECO:0000269|PubMed:11297529}.

Protein families:ICE2 family


   💬 WhatsApp