BAK_MOUSE   O08734


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O08734

Recommended name:Bcl-2 homologous antagonist/killer

EC number:

Alternative names:(Apoptosis regulator BAK)

Cleaved into:

GeneID:12018

Gene names  (primary ):Bak1

Gene names  (synonym ):Bak

Gene names  (ORF ):

Length:209

Mass:23295

Sequence:MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS

Tissue specificity:Widely expressed.

Induction:

Developmental stage:

Protein families:Bcl-2 family


   💬 WhatsApp