PACN1_MOUSE Q61644
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61644
Recommended name：Protein kinase C and casein kinase substrate in neurons protein 1
EC number：
Alternative names：(Syndapin-1)
Cleaved into：
GeneID：23969
Gene names (primary )：Pacsin1
Gene names (synonym )：Pacsin
Gene names (ORF )：
Length：441
Mass：50575
Sequence：MSGSYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAGDRGSVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI
Tissue specificity：Highly expressed in brain. Detected in hippocampus and dorsal root ganglion neurons. Detected in rod photoreceptor terminals in the outer plexiform layer of the retina (at protein level). In CNS neurons, high levels in the pyramidal cells of the hippocampus, Purkinje cells of the cerebellum and large neurons of the cortex and brain stem. {ECO:0000269|PubMed:11082044, ECO:0000269|PubMed:21926968, ECO:0000269|PubMed:23035120, ECO:0000269|PubMed:9746365}.
Induction：
Developmental stage：Expression is seen at embryonic day 17 and is up-regulated developmentally with a correlation to neuronal differentiation.
Protein families：PACSIN family