DPP2_RAT Q9EPB1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EPB1
Recommended name：Dipeptidyl peptidase 2
EC number：EC:3.4.14.2
Alternative names：Dipeptidyl aminopeptidase II Dipeptidyl peptidase 7 Dipeptidyl peptidase II (DPP II) Quiescent cell proline dipeptidase
Cleaved into：
GeneID：83799
Gene names (primary )：Dpp7
Gene names (synonym )：Dpp2
Gene names (ORF )：
Length：500
Mass：55,114
Sequence：MGLHPCSPVDHGVPSWVLVLLLTLGLCSLQATADSVLDPDFRENYFEQYMDHFNFESFSNKTFGQRFLVSDKFWKMGEGPIFFYTGNEGDIWSLANNSGFIVELAAQQEALLVFAEHRYYGKSLPFGVQSTQRGYTQLLTVEQALADFAVLLQALRHNLGVQDAPTIAFGGSYGGMLSAYMRMKYPHLVAGALAASAPVIAVAGLGNPDQFFRDVTADFYGQSPKCAQAVRDAFQQIKDLFLQGAYDTISQNFGTCQSLSSPKDLTQLFGFARNAFTVLAMMDYPYPTNFLGPLPANPVKVGCERLLSEGQRIMGLRALAGLVYNSSGMEPCFDIYQMYQSCADPTGCGTGSNARAWDYQACTEINLTFDSNNVTDMFPEIPFSDELRQQYCLDTWGVWPRPDWLQTSFWGGDLKAASNIIFSNGDLDPWAGGGIQRNLSTSIIAVTIQGGAHHLDLRASNSEDPPSVVEVRKLEATLIREWVAAARLKQPAEAQWPGPK
Tissue specificity：Predominantly expressed in kidney, but also expressed in a variety of tissues.
Induction：
Developmental stage：
Protein families：