EDIL3_MOUSE O35474
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35474
Recommended name：EGF-like repeat and discoidin I-like domain-containing protein 3
EC number：
Alternative names：(Developmentally-regulated endothelial cell locus 1 protein) (Integrin-binding protein DEL1)
Cleaved into：
GeneID：13612
Gene names (primary )：Edil3
Gene names (synonym )：Del1
Gene names (ORF )：
Length：480
Mass：53712
Sequence：MKHLVAAWLLVGLSLGVPQFGKGDICNPNPCENGGICLSGLADDSFSCECPEGFAGPNCSSVVEVASDEEKPTSAGPCIPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEEMVFRGNVDNNTPYANSFTPPIKAQYVRLYPQICRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWMVHQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARFIRILPWSWYGRITLRSELLGCAEEE
Tissue specificity：Expressed in angioblasts and early endothelial cells. By embryonic day 13.5, also expressed in a restricted group of non-endothelial cells including chondrocytes and retinal neurons.
Induction：
Developmental stage：Expressed in the embryo from day 7. After day 15.5, expression decreases and disappears completely by the time of birth.
Protein families：