WNT9B_MOUSE   O35468


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35468

Recommended name:Protein Wnt-9b

EC number:

Alternative names:(Protein Wnt-14b) (Protein Wnt-15)

Cleaved into:

GeneID:22412

Gene names  (primary ):Wnt9b

Gene names  (synonym ):Wnt14b Wnt15

Gene names  (ORF ):

Length:359

Mass:38982

Sequence:MRPAPALALAALCLLVLPAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAFLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSPGTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR

Tissue specificity:

Induction:

Developmental stage:Detected throughout the Wolffian duct epithelium from 9.5 dpc to 14.5 dpc. Detected in the stalk region of the ureteric bud at 10.5 to 11.0 dpc. Continues to be expressed in the developing collecting duct system throughout nephrogenesis, but is not detected at branching tips. Within the urogenital tract, expression is restricted to the kidney at 15.5 dpc (PubMed:16054034). Detected in embryonic head from early headfold stages to at least 12 dpc. {ECO:0000269|PubMed:16054034, ECO:0000269|PubMed:25257647}.

Protein families:Wnt family


   💬 WhatsApp