SEBOX_MOUSE P70368
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70368
Recommended name：Homeobox protein SEBOX
EC number：
Alternative names：(Homeobox OG-9) (Skin-, embryo-, brain- and oocyte-specific homeobox)
Cleaved into：
GeneID：18292
Gene names (primary )：Sebox
Gene names (synonym )：Og9x
Gene names (ORF )：
Length：190
Mass：20391
Sequence：MASPVEASPGCASGLGPHRRKRTTFSVGQLVELERVFAARPYPDISTREHLAQVTHLPEAKIQVWFQNRRAKRIKDRKPGALNSRLELPPNSCSLPDTPQLPWDPGTSSHPLHPTSSAQYTSACPPQTSCLGPILGPGQSWSGAKVAAPWGTSGASGIHSSLEQIVPQTSLGNLSDLIYTSAIVTNVDHF
Tissue specificity：Expressed in brain, skin, ovary and liver. Also expressed in maturing oocytes, eggs, zygotes and 2-cell embryos, but not 4-cell embryos. {ECO:0000269|PubMed:10922053, ECO:0000269|PubMed:8855241}.
Induction：
Developmental stage：Expressed in embryos from day 7. Expression is low in 12 day embryos and higher in 18 and 19 day embryos. {ECO:0000269|PubMed:10922053, ECO:0000269|PubMed:8855241}.
Protein families：Paired homeobox family