FGF20_RAT   Q9EST9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EST9

Recommended name:Fibroblast growth factor 20

EC number:

Alternative names:

Cleaved into:

GeneID:66017

Gene names  (primary ):Fgf20

Gene names  (synonym ):

Gene names  (ORF ):

Length:212

Mass:23,537

Sequence:MAPLTEVGAFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNGKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLVYTG

Tissue specificity:Preferentially expressed in brain; substantia nigra pars compacta. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp