APBB3_RAT   O35827


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35827

Recommended name:Amyloid-beta A4 precursor protein-binding family B member 3

EC number:

Alternative names:

Cleaved into:

GeneID:117026

Gene names  (primary ):Apbb3

Gene names  (synonym ):Fe65l2 Imported

Gene names  (ORF ):

Length:504

Mass:54,907

Sequence:MLGKDYMLAIILVNCDDDLWGDQNLEGETGLPPGWRKIRDAAGTYYWHVPSGSTQWQRPTWELAEDPGTGKEGIWELRPPKGRSFSSLDSSLNRSNSLTWYNEDSYVRSLEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQARNRSQPHDGAWGEGQNMLMVLKKDAMSLLNPLDHSLIHCQPLVHIRVWGVGSSKGRDRDFAFVAGDKDSCMLKCHVFRCDVPAKAIASRLQGLCAQILSERVGLSGEAACCSPDPISPEDFPRQVELLDAVSQAAQKYEALYMGILPVTKAMGMDVLNEAIGTLTGRGDRKTWVPAMLSVSDSLMTAHPIQAEAGAEEEPLWQCPVRLVTFIGVGHDPHTFGLIADLGCQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPPPLLKGGVGGAGAAPRKRGVFSFLDAFRLKPLFSICPKLILEGWGKRLYTLPVPRVL

Tissue specificity:Expressed predominantly in brain and testis. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp