VKOR1_RAT   Q6TEK4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6TEK4

Recommended name:Vitamin K epoxide reductase complex subunit 1

EC number:EC:1.17.4.4

Alternative names:Vitamin K1 2,3-epoxide reductase subunit 1

Cleaved into:

GeneID:309004

Gene names  (primary ):Vkorc1

Gene names  (synonym ):

Gene names  (ORF ):

Length:161

Mass:17,783

Sequence:MGTTWRSPGRLRLALCLAGLALSLYALHVKAARARNEDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGADSILNQSNSIFGCMFYTIQLLLGCLRGRWASILLILSSLVSVAGSLYLAWILFFVLYDFCIVCITTYAINAGLMLLSFQKVPEHKVKKP

Tissue specificity:Highly expressed in liver. Detected at lower levels in lung, kidney and testis. 1

Induction:

Developmental stage:

Protein families:VKOR family


   💬 WhatsApp