CHIC1_MOUSE   Q8CBW7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CBW7

Recommended name:Cysteine-rich hydrophobic domain-containing protein 1

EC number:

Alternative names:(Brain X-linked protein)

Cleaved into:

GeneID:12212

Gene names  (primary ):Chic1

Gene names  (synonym ):Brx

Gene names  (ORF ):

Length:227

Mass:25791

Sequence:MSILLPNMAEFDTISELEEEEEAATSSSSPSSSPSSSSSSSVSGPDEDEEDEEEEEEEDEEEEDEEEEEEEVPPPPRVVSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRVNSCLKKALPVNVKWLLCGCLCCCCTLGCSLWPVICLNKRTRRSIQKLLEWENNRLYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYPIFRPD

Tissue specificity:Expressed moderately in the brain. {ECO:0000269|PubMed:9321471}.

Induction:

Developmental stage:Detected in the 7, 11, 15, or 19 dpc. {ECO:0000269|PubMed:9321471}.

Protein families:CHIC family


   💬 WhatsApp