MCP_RAT   Q9Z0M4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z0M4

Recommended name:Membrane cofactor protein

EC number:

Alternative names:

Cleaved into:

GeneID:29333

Gene names  (primary ):Cd46

Gene names  (synonym ):Mcp

Gene names  (ORF ):

Length:355

Mass:39,787

Sequence:MTAAPLTPDPTHPRRRRKSYTFFSLGIYAEALLFLLSSLSDACEPPPPFEAMELKDKPKPHYAIGEIIEYTCKKGYLYLSPYPMTAICQPNHTWVPISDHGCIKVQCTMLQDPSFGKVHYIDGRFSWGARVKYTCMNGYYMVGMSVLQCELNGNGDAFWNGHPPSCKKVYCLPPPKIKNGTHTFTDIKVFKYHEAVIYSCDPNPGPDKFSLVGPSMLFCAGHNTWSSDPPECKVVKCPFPVLQNGRQISRTEKKFSYQALVLFQCLEGFYMEGSSMVVCGAKSSWEPSIPQCLKGPKPHSTKPPVYSESGYPSPREGIFGQEFDAWIIALIVVTSVVGVIVICLIILRCSEYRKK

Tissue specificity:Specifically expressed in testis. Within testis, present only in elongated spermatids and spermatozoa (at protein level). 3 s

Induction:

Developmental stage:Not expressed in embryonic and immature rats. Expressed in parallel with synthesis of spermatids. 1

Protein families:


   💬 WhatsApp