MEIS2_MOUSE P97367
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97367
Recommended name：Homeobox protein Meis2
EC number：
Alternative names：(Meis1-related protein 1)
Cleaved into：
GeneID：17536
Gene names (primary )：Meis2
Gene names (synonym )：Mrg1 Stra10
Gene names (ORF )：
Length：477
Mass：51728
Sequence：MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMGMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMVMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
Tissue specificity：Displays spatially restricted expression patterns in the developing nervous system, limbs, face, and in various viscera. In adult, it is mainly expressed in the brain and female genital tract, with a different distribution of the alternative splice forms in these organs. Lower expression in lung and only basal level in heart, liver, kidney, spleen, and testis. Expressed in pancreatic islets (beta-cells only) (PubMed:21059917). {ECO:0000269|PubMed:21059917}.
Induction：By retinoic acid.
Developmental stage：Expressed at high levels in all stages of embryonic development analyzed (7 days to 17 days). First detected around 10.5 dpc in the developing ventrolateral telencephalon. Is found at moderate levels throughout the ventricle zone (VZ) of the entire telencephalon with the exception of the ventro- and dorso-medial regions. The highest expression is detected in the subventricular zone (SVZ) of the lateral ganglionic eminence (LGE) and developing striatum. By 16.5 dpc, also found in the cortical plate. Also expressed at high levels in the caudal ganglionic eminence (CGE) and amygdala. Expression in the telencephalon remains unchanged at birth and into adulthood. {ECO:0000269|PubMed:10842069}.
Protein families：TALE/MEIS homeobox family