CACO2_MOUSE   A2A6M5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2A6M5

Recommended name:Calcium-binding and coiled-coil domain-containing protein 2

EC number:

Alternative names:(Nuclear domain 10 protein NDP52) (Nuclear domain 10 protein 52)

Cleaved into:

GeneID:76815

Gene names  (primary ):Calcoco2

Gene names  (synonym ):Ndp52 Ndp52l1

Gene names  (ORF ):

Length:331

Mass:40136

Sequence:MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHEQLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEKEKASWEEEKASWEKEKAPWEVEKAPWKEVKAYWWNDLHR

Tissue specificity:

Induction:

Developmental stage:Expression is limited to the pluripotent cells of the early embryo and the germline. Expressed in blastocysts, epiblasts and purified primordial germ cells. {ECO:0000269|PubMed:12620990}.

Protein families:CALCOCO family


   💬 WhatsApp