TRI44_MOUSE Q9QXA7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXA7
Recommended name：Tripartite motif-containing protein 44
EC number：
Alternative names：(Protein DIPB) (Protein Mc7)
Cleaved into：
GeneID：80985
Gene names (primary )：Trim44
Gene names (synonym )：Dipb
Gene names (ORF )：
Length：346
Mass：38272
Sequence：MASGVGAACEELPPDGTCDECEPDEAPGAEEVCRDCGFCYCRRHADAHRQKFLSHRLAAYVHGAQAWTPPASGGDDALPEDAEAKGEAEGEVESEVGEEESETEVDSESEEESETEEDSEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHRGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKIFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Tissue specificity：Expressed mainly in brain with high level in cerebral hemispheres and cerebellum. Lower expression in kidney, lung and spleen. In brain is detected in the hippocampus, thalamic and pretectal nuclei, substantia nigra, the dorsal part of the medulla, the cerebellum, in the olfactory nucleus, other cortical areas apart from hyppocampus and the striatum. Indeed expression is confined in neuronal somata namely in the CA3 region and dentate gyrus of the hyppocampus, caudate-putamen, parabranchial nucleus, olfactory nucleus, cortex, deep cerebellar nuclei and thalamus. Also highly expressed in the spleen. thymus and testis. {ECO:0000269|PubMed:19358823}.
Induction：
Developmental stage：Expression was detected in brain at 14 dpc and 18 dpc. At P5 expression in cerebellum is detected in both the dividing neuroblasts and post-mitotic neurons of the external granular layer as well as in the developing granule neurons of the internal granular layer while the expression in Purkinje cells was lower. At P10 the expression in external and internal granular layers remained strong while at the same time the Purkinje cells also acquired significant level of expression.
Protein families：