ACSF2_RAT   Q499N5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q499N5

Recommended name:Medium-chain acyl-CoA ligase ACSF2, mitochondrial Curated

EC number:EC:6.2.1.2

Alternative names:

Cleaved into:

GeneID:619561

Gene names  (primary ):Acsf2

Gene names  (synonym ):

Gene names  (ORF ):

Length:615

Mass:67,886

Sequence:MAVYLGMLRLGRLCVASLGARGPRTPLSRPWPNSKLQGVRAFSSGMVDCTNPLPIGGLSYIQGHTDSHLVNKTVGECLDATAQRFPNREALVIIHENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVSVNPAYQASELEYVLRKVGCKGIVFPKQFKTQQYYNILKQVCPELEKAQPGALKSERLPDLTTVISVDAPLPGTLLLDEVVAAGGKEQNLAQLRYHQGFLSCYDPINIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRLKMPAKTAEELRMVLPCPLYHCLGSVGGTMVSVVHGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTTIRGGVIAGSLAPPELIRAIISKMNMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVNMETGELTKLNMPGELCIRGYCVMQGYWGEPQKTFETVGQDRWYRTGDIASMDEQGFCRIVGRSKDMIIRGGENIYPAELEDFFHKHPQVQEAQVVGVKDDRMGEEICACIRLKSGETTTEEEIKAFCKGKISHFKIPRYIVFVEGYPLTVSGKIQKFKLREQMEQHLKL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp