CP2A5_MOUSE P20852
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20852
Recommended name：Cytochrome P450 2A5
EC number：EC 1.14.14.1
Alternative names：(CYPIIA5) (Coumarin 7-hydroxylase) (Cytochrome P450-15-COH) (Cytochrome P450-IIA3.2)
Cleaved into：
GeneID：
Gene names (primary )：Cyp2a5
Gene names (synonym )：Cyp2a-5
Gene names (ORF )：
Length：494
Mass：56741
Sequence：MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIGNFLQLNTEQMYNSLMKISQRYGPVFTIYLGPRRIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVVFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSMGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQAPQDIDVSPRLVGFATIPPTYTMSFLSR
Tissue specificity：Liver, with a strong circadian rhythmicity. Circadian expression is regulated by DBP. {ECO:0000269|PubMed:10490589}.
Induction：
Developmental stage：In liver; activity 6 fold higher in females than in males.
Protein families：Cytochrome P450 family