GSTA5_RAT P46418
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P46418
Recommended name：Glutathione S-transferase alpha-5
EC number：EC:2.5.1.18
Alternative names：GST A5-5 Glutathione S-transferase Yc-2 (GST Yc2)
Cleaved into：
GeneID：494500
Gene names (primary )：Gsta5
Gene names (synonym )：Gstyc2
Gene names (ORF )：
Length：221
Mass：25,347
Sequence：MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS
Tissue specificity：Liver, nasal mucosa and epididymis.
Induction：Liver from adult female rats contains about 10-fold greater levels of YC2 than is found in liver from adult male rats.
Developmental stage：By ethoxyquin, oltipraz, butylated hydroxyanisole, and phenobarbitol.
Protein families：