TOR2A_MOUSE   Q8R1J9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R1J9

Recommended name:Torsin-2A

EC number:

Alternative names:(Torsin family 2 member A)

Cleaved into:

GeneID:30933

Gene names  (primary ):Tor2a

Gene names  (synonym ):

Gene names  (ORF ):

Length:321

Mass:35897

Sequence:MAVARHGYRPWGSILGLLGLALAAAAAWDVASLRCTFGSFCECDFWPDLPGLECDLAQHLAGQHLAKALVVKSLKAFVQDPAPSKPLVLSLHGWTGTGKSYVSSLLAQHLFRDGLRSPHVHHFSPIIHFPHPSRTEQYKKELKSWVQGNLTACGRSLFLFDEMDKLPPGLMEVLQPFLGPSWVVYGTNYRKAIFIFISNAGGEQINQVALEAWRSHRDREEISLQEVEPVISRAVMDNPQHGFWRSGIMEEHLLDAVVPFLPLQRHHVRHCVLNELAQLGLEPSEEVVQAVLDSTTYFPEVEQLFSSNGCKTVASRLTFFL

Tissue specificity:Expressed at similar levels in liver, muscle and brain (at protein level). {ECO:0000269|PubMed:20015956}.

Induction:

Developmental stage:At 16 dpc, widely expressed in all tissues tested. {ECO:0000269|PubMed:16364897, ECO:0000269|PubMed:20015956}.

Protein families:ClpA/ClpB family, Torsin subfamily


   💬 WhatsApp