ELMD3_MOUSE Q91YP6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91YP6
Recommended name:ELMO domain-containing protein 3
EC number:
Alternative names:(RNA-binding motif and ELMO domain-containing protein 1)
Cleaved into:
GeneID:232089
Gene names (primary ):Elmod3
Gene names (synonym ):Rbed1
Gene names (ORF ):
Length:381
Mass:42659
Sequence:MSETSCSFFIEKEFQDGQLENVSAGLSSSYKDKGALMAFRGIPISELTNHGILQALTAETNGWQPGVVSEEVLRAQEEWEVVDTIHPDIESGVHCQQPGQLISFNEALEHFQSVDLSSFKKRIQPTIQRTGLAALRHCLFGPPKLHQGLREERDLVLTIAQCGLDSQNPTHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTFLMAQEIFRLSHHHIQQFPFCLMSVNITRIAIQALREECLSRECNRRQKVIPVVNSFYAATFLHLARVWRTQQKTILDSGFVLKDLEALAKKSPKRLLKTLDDYLAQVSKGQTSLLEAHKRPGSQGPHSRDLTFTGVCDLQSHSFESAGLI
Tissue specificity:Both isoform 1 and isoform 2 are widely expressed. {ECO:0000269|PubMed:24039609}.
Induction:
Developmental stage:Both isoform 1 and isoform 2 are expressed postnatally in the inner ear. Expression increases from P0 to P30 in both cochlear and vestibular tissues; at all time points, isoform 2 is expressed at several-fold higher levels than isoform 1. At P14, in the organ of Corti, detected along the length of stereocilia of hair cells, particularly in the upper half. Also observed in the microvilli on the apical surface of the hair cells. More abundant in the stereocilia of inner hair cells than in those of outer hair cells (at protein level). In the vestibular sensory epithelium, localizes within the hair cell and supporting cell bodies in the saccule and utricule. Not detected in vestibular hair bundles (at protein level). {ECO:0000269|PubMed:24039609}.
Protein families: