TESK2_RAT Q924U5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q924U5
Recommended name:Dual specificity testis-specific protein kinase 2
EC number:EC:2.7.12.1
Alternative names:Testicular protein kinase 2
Cleaved into:
GeneID:170908
Gene names (primary ):Tesk2
Gene names (synonym ):
Gene names (ORF ):
Length:570
Mass:63,559
Sequence:MDRSKRNSIAGFPPRVERLEEFEGGGGGDGNTVQVGRVSSSSYRAIISAFSRLTSLDDFTREKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANLLKEMQLMNRLSHPNILRFMGVCVHQGQLHALTEYINSGNLEQLLDSNLYLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRDENGYSAVVADFGLAEKIPDASIGSEKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPSDFLQLTFNCCNMDPKLRPSFEEIGKTLEEIMSRLQEEELERDRKLQPTAKGLLEKVPGGKRLSSLDDKIPHKSPRPRRTIWLSRSQSDIFSRKPPRTVNVLDPYYQPRDGATHTPKVNPFSARQDLKGGKVKFFDLPSKSVISLVFDLDAPGPGTVSLADCQEPLAPSSRRWRSLPGSPEFLHQACPFVGCEESLSDGPPPRLSSLKYRVREIPPFRTSALSATSAHEAMDCSNPQEENGFVPRPKGTSPCSGAASEEMEVEEERPRRAPVHFSISGISLQTQGEQDG
Tissue specificity:Predominantly expressed in testis and prostate. Found predominantly in non-germinal Sertoli cells.
Induction:
Developmental stage:
Protein families: