CIRBP_MOUSE   P60824


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P60824

Recommended name:Cold-inducible RNA-binding protein

EC number:

Alternative names:(A18 hnRNP) (Glycine-rich RNA-binding protein CIRP)

Cleaved into:

GeneID:12696

Gene names  (primary ):Cirbp

Gene names  (synonym ):Cirp

Gene names  (ORF ):

Length:172

Mass:18607

Sequence:MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Tissue specificity:Ubiquitous.

Induction:Up-regulated upon mild cold-shock and hypoxia. {ECO:0000269|PubMed:9151692}.

Developmental stage:

Protein families:


   💬 WhatsApp