ICOS_MOUSE Q9WVS0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WVS0
Recommended name：Inducible T-cell costimulator
EC number：
Alternative names：(Activation-inducible lymphocyte immunomediatory molecule) (CD28 and CTLA-4-like protein) (CCLP) (CD28-related protein 1) (CRP-1) (CD antigen CD278)
Cleaved into：
GeneID：54167
Gene names (primary )：Icos
Gene names (synonym )：Ailim
Gene names (ORF )：
Length：200
Mass：22709
Sequence：MKPYFCRVFVFCFLIRLLTGEINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWLPVGCAAFVVVLLFGCILIIWFSKKKYGSSVHDPNSEYMFMAAVNTNKKSRLAGVTS
Tissue specificity：Expressed on activated T-cells and resting memory T-cells. High expression seen in the thymic medulla and in the germinal centers and T-cell zones of lymph nodes and Peyer patches. Expressed at low levels in the spleen. {ECO:0000269|PubMed:10617205, ECO:0000269|PubMed:10760791, ECO:0000269|PubMed:11006126}.
Induction：
Developmental stage：
Protein families：