MCIN_MOUSE Q3UZ45
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UZ45
Recommended name:Multicilin
EC number:
Alternative names:(Multiciliate differentiation and DNA synthesis-associated cell cycle protein) (McIdas protein) (Protein Idas)
Cleaved into:
GeneID:622408
Gene names (primary ):Mcidas
Gene names (synonym ):Gm6320 Idas Mci Mcin
Gene names (ORF ):
Length:379
Mass:41148
Sequence:MQACEGSAAGRRAFDSICPNRMLDLSRRTLGKPGKPERKFVPSWKSFSGCGGGSPVAVYEDPPDAEPAPLPALTTIDLQDLADCTSLLGTEASPSGDSSASQNPSLQTEEDFNLQNFRDAMDDLIADSSSLMSPPLTNSDFPFSPCDVSSFGSCLSPSLDPPALGSPDLPPPPTEQYWKEVADQNQRALGTALIENNQLHVTLTQKQEEIASLRERNVQLKELASRTRHLASVLDKLMITQSPAEPFQIKATTKRSLEELFCAAGQAGQGCAEVDAILRDISQRCEEALHNRDPKRPRLQPEPDSKDCSSRNLHGAFRGLRTDCSASSVNLSHSELEEGGSFSTPIRSHSTIRTLAFPQGKAFTIRTVTGGYKFRWVPS
Tissue specificity:
Induction:
Developmental stage:At 12.5 dpc expression is restricted to the developing mouse brain. High levels are detected in the cortical hem and the choroid plexus epithelium in the telencephalic midline by cells starting to differentiate (at protein level). {ECO:0000269|PubMed:21543332}.
Protein families:Geminin family