KLF10_MOUSE O89091
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O89091
Recommended name：Krueppel-like factor 10
EC number：
Alternative names：(GDNF-inducible factor) (Transcription factor GIF) (mGIF) (Transforming growth factor-beta-inducible early growth response protein 1) (TGFB-inducible early growth response protein 1) (TIEG-1)
Cleaved into：
GeneID：21847
Gene names (primary )：Klf10
Gene names (synonym )：Gdnfif Tieg Tieg1
Gene names (ORF )：
Length：479
Mass：51756
Sequence：MLNFGASLQQASEGKMELISEKPREGMHPWDKAEQSDFEAVEALMSMSCDWKSHFKKYLENRPVTPVSDTSEDDSLLPGTPDLQTVPAFCLTPPYSPSDFEPSQGSNLTASAPSTGHFKSFSDAAKPPGATPFKEEEKNPLAAPPLPKAQATSVIRHTADAQLCNHQSCPVKAASILNYQDNSFRRRTHGNVEATRKNIPCAAVSPNRSKPEPSTVSDGDEKAGAALYDFAVPSSETVICRSQPAPSSPVQKSVLVSSPTVSTGGVPPLPVICQMVPLPANNSLVSTVVPSTPPSQPPAVCSPVLFMGTQVPEGTVVFVVPQPVVQSPRPPVVSPSGTRLSPIAPAPGFSPSAARVTPQIDSSRVRSHICSHPGCGKTYFKSSHLKAHVRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPASAQ
Tissue specificity：
Induction：By TGF-beta and GDNF. Expressed in a circadian manner in the liver with a high at ZT14-18 and a low at ZT2 (at protein level). Expressed in a circadian manner in the bone, kidney and skeletal muscle. Up-regulated in response to glucose. {ECO:0000269|PubMed:20070857, ECO:0000269|PubMed:20385766, ECO:0000269|PubMed:9348334}.
Developmental stage：
Protein families：Sp1 C2H2-type zinc-finger protein family