5NT3A_MOUSE Q9D020
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D020
Recommended name：Cytosolic 5'-nucleotidase 3A
EC number：EC 3.1.3.5
Alternative names：(7-methylguanosine phosphate-specific 5'-nucleotidase) (7-methylguanosine nucleotidase) (Cytosolic 5'-nucleotidase 3) (Cytosolic 5'-nucleotidase III) (cN-III) (Lupin) (Pyrimidine 5'-nucleotidase 1) (P5'N-1) (P5N-1) (PN-I)
Cleaved into：
GeneID：107569
Gene names (primary )：Nt5c3a
Gene names (synonym )：Nt5c3
Gene names (ORF )：
Length：331
Mass：37252
Sequence：MDRAAVARVGAVASASVCAVVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Tissue specificity：Isoform 2 is highly expressed in the brain, heart, spleen, kidney and blood. Isoform 2 is expressed (at protein level) in the spleen, skeletal muscle and gastrointestinal epithelia.
Induction：
Developmental stage：Isoform 2 is weakly expressed from 7.5 dpc and the expression level steadily increases through gestation. At 9.5 dpc and 10.5 dpc is first detected colocalizing with embryonic blood cells within the region of the septum transversum and within the cardiac chambers and dorsal aorta. At 12.5 dpc expression is found in the ventral neural tube and in the trigeminal ganglia and in the liver and dorsal root ganglia. Expression persists in the liver, dorsal root and trigeminal ganglia at 13.5 dpc and weaker expression becomes apparent in cardiac and skeletal muscle. At 16.5 dpc expression is detected in liver, myocardium, tongue, bronchial epithelium, gastrointestinal epithelium, cartilage and forebrain neuroepithelium.
Protein families：Pyrimidine 5'-nucleotidase family