BTG3_MOUSE   P50615


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P50615

Recommended name:Protein BTG3

EC number:

Alternative names:(Abundant in neuroepithelium area protein) (BTG family member 3) (Protein Tob5)

Cleaved into:

GeneID:12228

Gene names  (primary ):Btg3

Gene names  (synonym ):Ana Tob5

Gene names  (ORF ):

Length:252

Mass:28983

Sequence:MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTQILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENEDENKDEISKKVSRALDKVTSDYHSGSSSSDEDTSKEVDVKPSSVAATPSPVYQISELIFPPLPMWHPLPRKKPGMYRGSGHQTHYPPPVPFAYPNPGRKNKPFRPIPVTWVPPPGMHCDRNHWINPHMLAPH

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:9067576}.

Induction:

Developmental stage:

Protein families:BTG family


   💬 WhatsApp