OBRG_MOUSE O89013
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O89013
Recommended name：Leptin receptor gene-related protein
EC number：
Alternative names：(Endospanin-1) (OB-R gene-related protein) (OB-RGRP)
Cleaved into：
GeneID：230514
Gene names (primary )：Leprot
Gene names (synonym )：Lepr Obr
Gene names (ORF )：
Length：131
Mass：14316
Sequence：MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGLPVVLARVDVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW
Tissue specificity：Widely distributed in the brain, with elevated expression in the hypothalamic regions, including the paraventricular nucleus. In the placenta, present at high levels in the junctional zone situated towards the maternal aspect and throughout the labyrinth zone in close proximity to the developing fetus. {ECO:0000269|PubMed:10849209}.
Induction：Up-regulated in the liver of fasting animals. {ECO:0000269|PubMed:19907080}.
Developmental stage：
Protein families：OB-RGRP/VPS55 family