CD3D_RAT P19377
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P19377
Recommended name：T-cell surface glycoprotein CD3 delta chain
EC number：
Alternative names：CD3d
Cleaved into：
GeneID：25710
Gene names (primary )：Cd3d
Gene names (synonym )：T3d
Gene names (ORF )：
Length：173
Mass：19,356
Sequence：MEHYGILVSLLLATVLPQGSPFKIEVVEYEDKVFVNCNTSIRHLDGSVERWLTKNKSLILGKGILDPRGMYMCNGTEELAKEVSTVQVYYRMCQNCVELDSATLAGVIITDLIATLLLALGVYCFAGHETGRLSGAVDTQVLLKNEQLYQPLRDRDDAQYSRLGGNWPRNKRS
Tissue specificity：CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells. By Similarity
Induction：
Developmental stage：
Protein families：