BRAP_MOUSE   Q99MP8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99MP8

Recommended name:BRCA1-associated protein

EC number:EC 2.3.2.27

Alternative names:(BRAP2) (Impedes mitogenic signal propagation) (IMP) (RING-type E3 ubiquitin transferase BRAP2)

Cleaved into:

GeneID:72399

Gene names  (primary ):Brap

Gene names  (synonym ):

Gene names  (ORF ):

Length:591

Mass:66991

Sequence:MSVSLVVIRLELAGHSPVPTDFGFSAAAGEMSDEEIKKKTLASAVACLEGKSAGEKAAIIHQHLGRREMTDVIIETMKARADEVRDTVEEKKPSAAPVSAQRSREQSESVNTAPESPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCVLTVPATMTSHDLMKFVAPFNDVIEQMKIIRDSTPNQYMVLIKFSAQADADSFYMACNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDSLELRLSDLLKEKQSVERKCTQLNTRVAKLSTELQEEQELNKCLRANQLVLQNQLKEEEKLLKETCAQKDLQITEIQEQLRDVMFYLETQQQISHLPAETRQEIQEGQINIAMASAPNPPSSGAGGKLQSRKGRSKRGK

Tissue specificity:Isoform 2 is highly expressed in testis, lower levels in brain, heart, lung, stomach, colon, uterus, liver and kidney. Isoform 1 is only expressed in the testis. Isoform 2 is predominant over isoform 1 in both fetal and adult testis. {ECO:0000269|PubMed:14607334}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp