RTL4_MOUSE Q3URY0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3URY0
Recommended name：Retrotransposon Gag-like protein 4
EC number：
Alternative names：(Mammalian retrotransposon-derived protein 4) (Sushi-XF2b protein) (Sushi-ichi-related retrotransposon homolog 11) (Zinc finger CCHC domain-containing protein 16)
Cleaved into：
GeneID：619287
Gene names (primary )：Rtl4
Gene names (synonym )：Mar4 Mart4 Sirh11 Zcchc16
Gene names (ORF )：
Length：304
Mass：34266
Sequence：MEKCTESLPNLNAETSFLRGGNLILQPQVQHPTDDKPPITGQVVPALNTPVMSGPYSGDHIPQFHGNPASVKGFFAQVTTYLRALDISNPADNARVKHFFDYLSQQMQNCDVLSESTQNNLLKQYENFVLELQQSFGEPMTQETTPPMNVTVDKSNISPQDATNFQLHAPNLSYRETNQRDQFQNGQADPTQNEEITDIMDNLPDLITQCIQLDKKHKDRPELLQSESHVPMFASTNHYQSFIGPVRPLPKDGPRQLQGAHLPVTPAKRARQQETQLCVYCNQAGHFTRDCLAKRSRTPARKKM
Tissue specificity：In adults, expressed in brain, eye, kidney, ovary and testis (PubMed:26402067, PubMed:15716091). Weakly expressed in thymus, heart and muscle (PubMed:15716091). {ECO:0000269|PubMed:15716091, ECO:0000269|PubMed:26402067}.
Induction：
Developmental stage：Expressed at 12.5 dpc in almost all tissues tested. Expressed at 14.5 dpc in brain, eye and liver. Weakly expressed in lung, heart and kidney. {ECO:0000269|PubMed:15716091, ECO:0000269|PubMed:26402067}.
Protein families：