ACVR1_MOUSE   P37172


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P37172

Recommended name:Activin receptor type-1

EC number:EC 2.7.11.30

Alternative names:(Activin receptor type I) (ACTR-I) (Serine/threonine-protein kinase receptor R1) (SKR1) (TGF-B superfamily receptor type I) (TSR-I) (TSK-7L)

Cleaved into:

GeneID:11477

Gene names  (primary ):Acvr1

Gene names  (synonym ):Acvrlk2 Tgfb1

Gene names  (ORF ):

Length:509

Mass:57226

Sequence:MVDGVMILPVLMMMAFPSPSVEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Tissue specificity:Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells.

Induction:

Developmental stage:Highly expressed in the node and midline and weakly expressed in 8.5 dpc embryos and in the lateral plate mesoderm. {ECO:0000269|PubMed:15531373}.

Protein families:Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily


   💬 WhatsApp