PTPRR_MOUSE Q62132
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62132
Recommended name：Receptor-type tyrosine-protein phosphatase R
EC number：EC 3.1.3.48
Alternative names：(R-PTP-R) (Phosphotyrosine phosphatase 13) (Protein-tyrosine-phosphatase SL)
Cleaved into：
GeneID：19279
Gene names (primary )：Ptprr
Gene names (synonym )：Ptp13
Gene names (ORF )：
Length：656
Mass：74036
Sequence：MRRAVGFPALCLLLNLHAAGCFSRNNDHFLAIRQKKSWKPVFIYDHSQDIKKSLDIAQEAYKHNYHSPSEVQISKHHQIINSAFPRPAYDPSLNLLAESDQDLEIENLPIPAANVIVVTLQMDITKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKNQVELFVSPGNRKPGETQALQAEEVLRSLNVDGLHQSLPQFGITDVAPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFIIIVTCLMIIYRLKERLQLSLRQDKEKNQEIHLSPIARQQAQSEAKTTHSMVQPDQAPKVLNVVVDPQGQCTPEIRNSTSTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGSVEPFVAVSTPREKVAMEYLQSASRVLTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNITDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVTGVTECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVE
Tissue specificity：Expressed in the heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis. Isoform alpha is expressed throughout the granular layer of the cerebellar but not within the Purkinje cells, also in the villi of the ileum and jejunum and both the villi and crypts of the duodenum. Isoform beta is expressed only in the Purkinje cells. Isoform gamma is expressed throughout the brain, the villi and crypts of the duodenum, jejunum and ileum and expressed at low levels in the proximal colon. {ECO:0000269|PubMed:10705342, ECO:0000269|PubMed:10949045, ECO:0000269|PubMed:7832766, ECO:0000269|PubMed:7836467}.
Induction：
Developmental stage：Isoform gamma is the only family member developmentally expressed. Expressed throughout the brain in 15.5 day embryos and in cranial nerve cells, skeletal tissues such as neural crest-derived face bones, and the periphery of cartilaginous skeletal elements including the rib and vertebrae anlage. On day 17.5, expression was observed throughout the brain, trigeminal ganglion, cranofacial bones, oral-facial structures, cervical vertebrae, axis and the ileum. Expression continued in the vertebral column throughout ossification. {ECO:0000269|PubMed:10949045}.
Protein families：Protein-tyrosine phosphatase family, Receptor class 7 subfamily