H4_RAT P62804
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62804
Recommended name：Histone H4
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：H4c2
Gene names (synonym )：Hist1h4b, Hist4
Gene names (ORF )：
Length：103
Mass：11,367
Sequence：MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Tissue specificity：OGP is found in serum. A potentially OGP-specific transcript is highly expressed in spleen with lower levels in lung, liver, thymus, spinal cord, pituitary gland, adrenal gland, bone marrow and lymph nodes as well as very low levels in kidney, heart and brain. 1
Induction：
Developmental stage：
Protein families：