BIRC5_MOUSE   O70201


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70201

Recommended name:Baculoviral IAP repeat-containing protein 5

EC number:

Alternative names:(Apoptosis inhibitor 4) (Apoptosis inhibitor survivin) (TIAP)

Cleaved into:

GeneID:11799

Gene names  (primary ):Birc5

Gene names  (synonym ):Api4 Iap4

Gene names  (ORF ):

Length:140

Mass:16298

Sequence:MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA

Tissue specificity:

Induction:

Developmental stage:

Protein families:IAP family


   💬 WhatsApp