TNR12_MOUSE Q9CR75
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CR75
Recommended name：Tumor necrosis factor receptor superfamily member 12A
EC number：
Alternative names：(Fibroblast growth factor-inducible immediate-early response protein 14) (FGF-inducible 14) (Fibroblast growth factor-regulated protein 2) (Tweak-receptor) (TweakR) (CD antigen CD266)
Cleaved into：
GeneID：27279
Gene names (primary )：Tnfrsf12a
Gene names (synonym )：Fgfrp2 Fn14
Gene names (ORF )：
Length：129
Mass：13641
Sequence：MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWPILGGALSLVLVLALVSSFLVWRRCRRREKFTTPIEETGGEGCPGVALIQ
Tissue specificity：Highly expressed in fetal heart, intestine, kidney, liver, lung and skin, and in adult heart and ovary. Intermediate expression in adult kidney, lung and skin.
Induction：By FGF-1.
Developmental stage：
Protein families：