SECR_RAT   P11384


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P11384

Recommended name:Secretin 1 Publication

EC number:

Alternative names:

Cleaved into:

GeneID:24769

Gene names  (primary ):Sct

Gene names  (synonym ):

Gene names  (ORF ):

Length:134

Mass:15,072

Sequence:MEPLLPTPPLLLLLLLLLSSSFVLPAPPRTPRHSDGTFTSELSRLQDSARLQRLLQGLVGKRSEEDTENIPENSVARPKPLEDQLCLLWSNTQALQDWLLPRLSLDGSLSLWLPPGPRPAVDHSEWTETTRQPR

Tissue specificity:In the brain, expressed in the central amygdala, hippocampus, area postrema, nucleus of the tractus solitary and cerebellum (PubMed:15276242). Expressed at higher level in the cerebellum (PubMed:15276242). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp